Wednesday, November 24, 2010

Assignment 4- Review of Recent Paper

The recent paper I read about Insulin can be found here: http://web.ebscohost.com.qe2a-proxy.mun.ca/ehost/pdfviewer/pdfviewer?hid=18&sid=96135bf0-6f32-4713-a674-482b3822d9f0%40sessionmgr14&vid=2



The title of the paper is : "Diet-induced central obesity and insulin resistance in rabbits".


This study looked at whether a high fat/ high sucrose diet administered to rabbits could result in obesity and insulin resistance. Male japanese white rabbits were dispersed into control and experimental groups. Control rabbits were fed a normal chow diet where as experimental group rabbits were fed the high fat/ high sucrose diet for 36 weeks. Plasma triglycerides, total cholesterol, insulin and glucose levels were measured. Intravenous glucose tolerance tests were also conducted to analyze glucose metabolism. Adipose tissue build up was also compared between the experimental and control rabbits. (Zhao et al. 2008)


The results found no significant difference in triglyceride, total cholesterol, glucose or insulin levels between the two groups over the course of the trial. However, the high fat/high sucrose fed rabbits showed impeded glucose clearance in connection with higher levels of insulin secretion compared to the control rabbits. Control rabbits also had less adipose tissue accumulation than rabbits in the experimental group. These results suggest that the high fat/ high sucrose diet leads to the induction of insulin resistance and weight gain in rabbits.  The study then suggests that rabbits can thus be used as a model for research on human insulin resistance and obesity. (Zhao et al. 2008)


Rabbits do appear to be a better model than rodents for studying insulin resistance in humans as their  lipoprotein profile is more similar. The high fat/ high sucrose diet fed to the rats also resulted in disorders which mimic those found in humans.  The figures presented in the article, such as those labelled figure 1 clearly show the increase glucose and insulin levels in the experimental rabbits compared to the control rabbits during the glucose clearance tests which indicates induced insulin resistance. 

imageQuickView.jpg



Although the amount of food consumption was no different among the two groups as clearly shown in figure 2, there was a significant increase in body weight of the high fat/ high sucrose fed rabbits. (Zhao et al. 2008)



imageQuickView.jpg



 As shown in both figures above taken from the study, the claims that a high fat/ high sucrose diet can result in insulin resistance and obesity seem to be supported.  This study was tested on male rabbits, it should be repeated with females to see if the same results will occur. 


To further explore this topic, more long term complications associated with insulin resistance and obesity in rabbits should be measured, for example the progression of heart disease such as arteriosclerosis. It could also be tested if whether these results can be reversed with a return to a healthier diet or treated with exercise. In order to test these treatments, you could take four groups of insulin resistant obese rabbits, subject one to no treatment as a control, treat one with a healthier chow only diet, treat the third group with increased exercise and treat the fourth group with improved diet and an increase in exercise. All groups could be measured for triglyceride level, total cholesterol, glucose and insulin levels as done in this study. Body weight measures and glucose tolerance tests could also be conducted to determine if there are any significant changes to the groups before and after treatments as well as compare the results between groups. It has been suggested that insulin resistance resulting in type 2 diabetes can often be treated or reversed with a switch to a healthier diet and increased exercise. Thus the expected result of these trials would be that all of the treatment groups would have a decrease in insulin resistance and improved overall health compared to the control group. The most significant effects would be expected in the rabbit group treated with both a healthy diet and exercise. 


References:


Zhao, S., Chu, Y., Zhang, C., Lin, Y., Xu, K., Yang, P., et al. (2008). Diet-induced central obesity and insulin resistance in rabbits. Journal of Animal Physiology & Animal Nutrition, 92(1), 105-111. doi:10.1111/j.1439-0396.2007.00723.x.

Wednesday, November 10, 2010

Assignment 3- Insulin Function and Pathology

Insulin is essential for normal growth and development. It is also the only hormone which functions to lower blood glucose levels. Without it, the body is unable to lower blood glucose levels which results in excess glucose production, ketogenesis, lipolysis, proteolysis and without intervention, ultimately death. An excess of Insulin results in hypoglycemia, which is a lack of blood glucose which can lead to brain failure and death. Thus, Insulin and its functions are extremely important for the body. (Hadley and Levine, 241)


High blood glucose levels trigger the release of Insulin from the pancreatic islets. It then acts on plasmalemmal receptors of a number of different types of cells, most importantly hepatic, muscle and adipose tissue cells. On all of these cells, insulin functions to stimulate the uptake of glucose where it can be metabolized and stored as glycogen or used in the synthesis of proteins or fats.


In fat cells, insulin stimulates glucose uptake which results in increased catabolism of sugar to glycerol. it also activates endothelial cell lipoprotein lipase which triggers the release of FFAs from chylomicrons. the fatty acids are then transported into fat cells where along with glycerol they form triglycerides. These are then added to lipid droplets within adipose cells. this lipid synthesis is stimulated by insulin because it  activates enzymes involved such as citrate lipase, acetyl- CoA carboxylase, fatty acid synthase and glycerol-3-phosphate dehydrogenase.


Insulin also acts on the liver to activate glycogen synthetase which is an enzyme that works to stimulate glycogen formation from glucose. It also indirectly stimulates the conversion of intracellular glucose to glucose-6-PO4 which prevents the release of glucose from hepatocytes.


In muscle cells, insulin prompts the active transport of glucose and amino acids which thus enhances protein synthesis. 


Insulin is also plays a role in potassium homeostasis whereby insulin  stimulates potassium uptake by cells and can result in extracellular hypokalemia (Hadley and Levine 243).


The secretion of insulin is controlled by a number of physiological regulators including endocrine, neural and metabolic factors with blood glucose being the most important. As mentioned above, increased blood glucose levels stimulate the release of insulin. Insulin secretion is also stimulated by amino acids and is important in using these for protein synthesis. Catecholamines such as  adrenal epinephrine inhibit insulin secretion during stress. this is important so that glucose can be used by tissues that are active during stress response. 


Insulin is also involved in an important feedback loop with glucagon whereby increased glucagon stimulates insulin secretion from the beta cells of the pancreas and insulin then subdues glucagon secretion from the alpha cells. (Hadley and Levine 252-253)


Diabetes Mellitus is a disease characterized by high glucose levels in the blood resulting from a lack or resistance to insulin. It causes symptoms such as frequent urination and increased thirst. Left untreated, increased blood glucose greatly damages blood vessels leading to complications such as heart disease, possible amputations, blindness and death.


  Type 1 diabetes also known as insulin-dependent diabetes mellitus occurs when there is a decrease in the number of insulin containing beta cells within the pancreas. This may occur due to a hereditary predisposition or to the development of islet cell surface antibodies, however the signals responsible for production of these antibodies are unknown. There is evidence to suggest that type 1 juvenile onset diabetes can be caused by a virus or symptoms can manifest as a result of damage sustained by infections such as mumps or rubella. Onset of Type 1 diabetes usually occurs early in life. Juvenile onset diabetes occurs in youth where symptoms develop suddenly.  Type 1 diabetes is typically treated with regulated insulin injections. Insulin can not be taken orally since it is a protein and would be digested.  (Hadley and Levine 255-256).



diabetes1.jpg
http://gconnect.in/gc/lifestyle/let-natural-health-deal-with-your-diabetes.html


Type 2 diabetes is also known as non-insulin dependent diabetes mellitus arrises not from a lack of insulin as in type 1, but a reduced sensitivity of target tissues to the action of insulin. This is referred to as insulin resistance. Patients with Type 2 diabetes often have hyperinsulinemia, which is an elevation in blood insulin levels as a result of over secretion from the pancreas due to elevated blood glucose. Since target tissues are less sensitive to insulin, blood glucose levels remain high despite the increases in insulin . Type 2 diabetes was formerly referred to as adult onset diabetes because it was typically found in middle age adults who were obese or overweight. However, due to the increase incidence of obesity in children, there has been an increase in occurrence of type 2 diabetes in younger individuals. Therefore Type 2 diabetes is no longer referred to as an adult onset disease. Type 2 diabetes is responsible for approximately 90% of diabetes cases. It is often the result of poor lifestyle choices including bad diet and lack of exercise. This results in frequent high blood glucose levels and either not enough insulin to make up for it or an increased insensitivity of cells to insulin. Type 2 diabetes can thus be treated by improving one's lifestyle by managing diet and increasing exercise.  (Hadley and Levine 256-257).



028-type-2-diabetes.jpg

http://www.topnews.in/health/early-weight-loss-helps-patients-control-type-2-diabetes-23934

References: 



Hadley, Mac E., and Jon E. Levine. Endocrinology. 6th ed. Upper Saddle River, NJ: Pearson, 2006. 241,243, 252-253, 255-257. Print. 


http://gconnect.in/gc/lifestyle/let-natural-health-deal-with-your-diabetes.html


http://www.topnews.in/health/early-weight-loss-helps-patients-control-type-2-diabetes-23934

Wednesday, October 27, 2010

Assignment 2- Insulin Structure

Insulin is a polypeptide which includes an A chain comprised of 21 amino acids and a B chain of containing 30 amino acids. The two chains forming this dimer are attached via two disulfide bonds; one located between the 7th aa of the A chain and 7th aa of the B chain and 20th aa of the A chain and 19th aa of the B chain. Another intra-chain disulfide bond is located between the sixth and eleventh amino acids in the A chain.Insulin is synthesized from proinsulin which is derived from a preproinsulin precursor.Insulin is the active form which is derived when the c terminal 23 amino acid sequence is removed from the preproinsulin, the proinsulin molecule folds to provide disulfide linkage between the chains. The connecting peptide of the pro insulin is then cleaved by enzymes resulting in the final insulin product. (Hadley, and Levine 241-244)


Using NCBI, Blast and ClustalW, the protein sequences of human preproinsulin and preproinsulin of the chimpanzee and field rat were assessed and alligned. The allignment results can be viewed here: 



CLUSTAL 2.0.12 multiple sequence alignment
gi|4557671|ref|NP_000198.1|         MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFY 50
gi|57113877|ref|NP_001008996.1      MALWMRLLPLLVLLALWGPDPASAFVNQHLCGSHLVEALYLVCGERGFFY 50
gi|82749718|gb|ABB89743.1|          MALWMRFLPLLALLVVWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFY 50
                                    ******:****.**.:* *.** ***:*****.*****************
gi|4557671|ref|NP_000198.1|         TPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSIC 100
gi|57113877|ref|NP_001008996.1      TPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSIC 100
gi|82749718|gb|ABB89743.1|          TPKSRREVEDPQVPQLELGGSPEAGDLQTLALEVARQKRGIVDQCCTSIC 100
                                    ***:***.** ** *:****.* **.**.**** : ******:*******
gi|4557671|ref|NP_000198.1|         SLYQLENYCN 110
gi|57113877|ref|NP_001008996.1      SLYQLENYCN 110
gi|82749718|gb|ABB89743.1|          SLYQLENYCN 110
                                    **********


Figure 1: Allignment of protein sequence of Insulin from various species listed in Figure 2.


Figure one shows that the protein sequence of human preproinsulin is very similar and mostly identical to the protein sequences of preproinsulin in the chimpanzee as well as the field rat.



Sequence 1: gi|4557671|ref|NP_000198.1|      110 aa Human
Sequence 2: gi|57113877|ref|NP_001008996.1   110 aa Chimpanzee
Sequence 3: gi|82749718|gb|ABB89743.1|       110 aa Lesser rice-field rat

Figure 2: List of sequences corresponding to each species and number of amino acids


Sequences (1:2) Aligned. Score:  98
Sequences (1:3) Aligned. Score:  80
Sequences (2:3) Aligned. Score:  80

Figure 3: Comparison of protein sequence of each species by percent similarity score.


As shown in figure 3, Human preproinsulin is 98% similar to preproinsulin of the Chimpanzee and 80% with the field rat. This shows how much the structure of insulin is conserved among various species. 


Human insulin most often differs from other mammalian insulin in the 8th, 9th and 10th positions within the intra-chain disulfide bond of the A chain and the 30th position of the B chain. (Hadley, and Levine 241-244)


Insulin acts by activating plasma membrane receptors that have tyrosine kinase activity. The insulin receptor has alpha subunit that contains the insulin binding domain and a beta subunit that contains a tyrosine kinase domain. It contains two alpha and two beta subunits covalently attached by inter and intra subunit disulfide bridges. Insulin binds to the alpha subunits causing a conformational change in the receptor complex and the beta subunit is autophosphorylated  and becomes an activated tyrosine kinase which then phosphorylates multiple intracellular proteins. 

The major enzyme responsible for insulin degradation in the body is hepatic gluthione insulin dehydrogenase which acts by breaking insulin into its seperate A and B chains. The enzyme acts with glutathione which reduces the individual half cysteine moieties of the interchain disulfide bonds and acts as a cofactor for the dehydrogenase enzyme. (Hadley, and Levine 241-244)


References:


Hadley, Mac E., and Jon E. Levine. Endocrinology. 6th ed. Upper Saddle River, NJ: Pearson, 2006. 241-244. Print. 


http://www.ebi.ac.uk/Tools/clustalw2/index.html?




http://www.ncbi.nlm.nih.gov/BLAST/

 http://www.ncbi.nlm.nih.gov/

Wednesday, October 13, 2010

First Assignment: My Favorite Hormone- Insulin

Insulin is a peptide hormone produced by the beta cells of the islet of Langerhans in the pancreas. The term insulin comes from the Latin word for islet/island.  It was  first isolated by Nicolae Polescue in 1921. In 1958, the primary structure of insulin was discovered by Frederick Sanger, a British molecular biologist. Since it was the first protein sequence to be determined, he was awarded the Nobel prize in chemistry for his work. (De Meyts)



 Figure 1: Structure of Human Insulin.(http://rst.gsfc.nasa.gov/Sect20/A12.html)

 The biologically active circulating form of insulin is a monomer, which consists of two chains, an A chain with 21 amino acids and a B chain of 30 amino acids. (in humans). The A and B chains are linked by two disulfide bridges, A7-B7 and A20-B19. The A chain also contains an intra-chain disulfide bridge connecting A6 and A11. Insulin is produced and stored in the body as a hexamer. It is far more stable and non-reactive than the monomer form. The structure of insulin is well preserved in vertebrate animals, with slight variations in structure. Cow insulin differs from human insulin in only three amino acid residues, and pig insulin differs in only one. (Mayer, Zhang and DiMarchi)


Insulin functions to control blood glucose concentration. When released it stimulates cells in the liver, muscle and adipose tissue to take up glucose from the blood and store it as glycogen in the liver and muscle tissue. This also functions to stop the use of lipids as an energy source. When insulin is absent, glucose is not taken up by the body and lipids instead will be mobilized to the liver as an energy source. Insulin has also been shown to have effects on the brain such as improving cognition. Once in the brain, insulin enhances both learning and memory.  (Soria, Tuduri, Gonzalez, Martin, and Nadal 52-60)

References:

De Meyts, Pierre. "Insulin and its Receptor: Structure, Function and Evolution." BioEssays 26.12 (2004): n. pag. Web. 11 Oct 2010.

Mayer, John P., Faming Zhang, and Richard D. DiMarchi. "Insulin Structure and Function." Peptide Science 88.5 (2007): n. pag. Web. 11 Oct 2010.

Soria, Bernat, Eva Tuduri, Alejandro Gonzalez, Franz Martin, and Angel Nadal. "Pancreatic Islet Cells: a Model for Calcium-dependent Peptide Release." HFSP Journal 4.2 (2010): 52-60. Web. 11 Oct 2010.


http://www.microscopyu.com/galleries/pathology/index.html